PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN03193.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 229aa    MW: 26173.4 Da    PI: 9.2729
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN03193.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.54.6e-52141381128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrFhPtdeelv +yLk+kv + +l++ ++i+evd++k++PwdLp      e+e yfFs+++ ky++g+r+nrat+sgyWkatg dk+++++ +++
  KHN03193.1  14 LPPGFRFHPTDEELVLQYLKRKVFSCPLPA-SIIPEVDVCKSDPWDLPGD---LEQERYFFSTKEAKYPNGNRSNRATNSGYWKATGLDKQIVTSkGNQ 108
                 79****************************.89***************54...46799*********************************99885777 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 +vg+kktLvfy+g+ p+g++tdW+mheyrl
  KHN03193.1 109 VVGMKKTLVFYRGKPPHGSRTDWIMHEYRL 138
                 8***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.16E-619161IPR003441NAC domain
PROSITE profilePS5100558.16214161IPR003441NAC domain
PfamPF023652.0E-2715138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MEKVSFVKNG ELRLPPGFRF HPTDEELVLQ YLKRKVFSCP LPASIIPEVD VCKSDPWDLP  60
GDLEQERYFF STKEAKYPNG NRSNRATNSG YWKATGLDKQ IVTSKGNQVV GMKKTLVFYR  120
GKPPHGSRTD WIMHEYRLNI LNASQSHVPM ENWVLCRIFL KKRSGAKNGE ESNKVRNSKV  180
VFYDFLAQNK TDSSSSAASG ITHEHESDEH DHEESSSSNT FPYTIRTKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-531116714171NO APICAL MERISTEM PROTEIN
1ut4_B7e-531116714171NO APICAL MERISTEM PROTEIN
1ut7_A7e-531116714171NO APICAL MERISTEM PROTEIN
1ut7_B7e-531116714171NO APICAL MERISTEM PROTEIN
3swm_A9e-531116717174NAC domain-containing protein 19
3swm_B9e-531116717174NAC domain-containing protein 19
3swm_C9e-531116717174NAC domain-containing protein 19
3swm_D9e-531116717174NAC domain-containing protein 19
3swp_A9e-531116717174NAC domain-containing protein 19
3swp_B9e-531116717174NAC domain-containing protein 19
3swp_C9e-531116717174NAC domain-containing protein 19
3swp_D9e-531116717174NAC domain-containing protein 19
4dul_A7e-531116714171NAC domain-containing protein 19
4dul_B7e-531116714171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6619140.0EU661914.1 Glycine max NAC domain protein (NAC14) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001238078.11e-173NAC domain protein
SwissprotQ9FY931e-101NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0B2P6891e-173A0A0B2P689_GLYSO; NAC domain-containing protein 29
TrEMBLB2ZGQ71e-173B2ZGQ7_SOYBN; NAC domain protein
STRINGGLYMA18G53954.11e-173(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-100NAC domain containing protein 83
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]